SCOPe 2.07: Domain d5b1jc_: 5b1j C:

Lineage for d5b1jc_ (5b1j C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (29 species)
   not a true protein

7. Species Hyphomicrobium denitrificans [TaxId:53399] [188702] (2 PDB entries)

8. Domain d5b1jc_: 5b1j C: [326413]
   Other proteins in same PDB: d5b1ja1, d5b1ja2, d5b1jb1, d5b1jb2
   automated match to d3ef4a_
   complexed with cu

Details for d5b1jc_

PDB Entry: 5b1j, 3 Å

PDB Description: crystal structure of the electron-transfer complex of copper nitrite reductase with a cupredoxin

PDB Compounds: (C:) Blue copper protein

SCOPe Domain Sequences for d5b1jc_:

Sequence; same for both SEQRES and ATOM records:

>d5b1jc_ b.6.1.0 (C:) automated matches {Hyphomicrobium denitrificans [TaxId: 53399]}
aehivemrnkddagntmvfqpgfvkveagdtvkfvptdkshnaesvrevwpegvapvkgg
fskevvfnaekeglyvlkcaphygmgmvvlvqvgkpvnldqikeykatglakkrldgeia
kvvq

Timeline for d5b1jc_:

• d5b1jc_ first appeared in SCOPe 2.06
  
• d5b1jc_ appears in the current release, SCOPe 2.08