SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b1jc_ (5b1j C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2036241Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2036242Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2037693Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2037694Protein automated matches [190824] (22 species)
    not a true protein
  7. 2037880Species Hyphomicrobium denitrificans [TaxId:53399] [188702] (2 PDB entries)
  8. 2283112Domain d5b1jc_: 5b1j C: [326413]
    Other proteins in same PDB: d5b1ja1, d5b1ja2, d5b1jb1, d5b1jb2
    automated match to d3ef4a_
    complexed with cu

Details for d5b1jc_

PDB Entry: 5b1j (more details), 3 Å

PDB Description: crystal structure of the electron-transfer complex of copper nitrite reductase with a cupredoxin
PDB Compounds: (C:) Blue copper protein

SCOPe Domain Sequences for d5b1jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1jc_ b.6.1.0 (C:) automated matches {Hyphomicrobium denitrificans [TaxId: 53399]}
aehivemrnkddagntmvfqpgfvkveagdtvkfvptdkshnaesvrevwpegvapvkgg
fskevvfnaekeglyvlkcaphygmgmvvlvqvgkpvnldqikeykatglakkrldgeia
kvvq

SCOPe Domain Coordinates for d5b1jc_:

Click to download the PDB-style file with coordinates for d5b1jc_.
(The format of our PDB-style files is described here.)

Timeline for d5b1jc_:

  • d5b1jc_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-23