Lineage for d5b1ja2 (5b1j A:160-335)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381028Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2381772Protein automated matches [226877] (4 species)
    not a true protein
  7. 2381844Species Alcaligenes xylosoxydans [TaxId:85698] [225578] (6 PDB entries)
  8. 2381856Domain d5b1ja2: 5b1j A:160-335 [326383]
    Other proteins in same PDB: d5b1jc_
    automated match to d1oe1a2
    complexed with cu

Details for d5b1ja2

PDB Entry: 5b1j (more details), 3 Å

PDB Description: crystal structure of the electron-transfer complex of copper nitrite reductase with a cupredoxin
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d5b1ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1ja2 b.6.1.3 (A:160-335) automated matches {Alcaligenes xylosoxydans [TaxId: 85698]}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapip

SCOPe Domain Coordinates for d5b1ja2:

Click to download the PDB-style file with coordinates for d5b1ja2.
(The format of our PDB-style files is described here.)

Timeline for d5b1ja2: