SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ekdb_ (5ekd B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (46 species)
    not a true protein
  7. 2106130Species Human (Homo sapiens) [TaxId:9606] [188230] (4 PDB entries)
  8. 2282977Domain d5ekdb_: 5ekd B: [326278]
    automated match to d2el7b_
    protein/RNA complex; complexed with 5bx, atp, gol, mn

Details for d5ekdb_

PDB Entry: 5ekd (more details), 1.82 Å

PDB Description: human mitochondrial tryptophanyl-trna synthetase bound by indolmycin and mn*atp.
PDB Compounds: (B:) Tryptophan--tRNA ligase, mitochondrial

SCOPe Domain Sequences for d5ekdb_:

Sequence, based on SEQRES records: (download)

>d5ekdb_ c.26.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqkdskkrvfsgiqptgilhlgnylgaieswvrlqdeydsvlysivdlhsitvpqdpavl
rqsildmtavllacginpeksilfqqsqvsehtqlswilscmvrlprlqhlhqwkakttk
qkhdgtvglltypvlqaadillyksthvpvgedqvqhmelvqdlaqgfnkkygeffpvpe
siltsmkkvkslrdpsakmsksdpdklatvritdspeeivqkfrkavtdftsevtydpag
ragvsnivavhaavtglsveevvrrsagmntaryklavadaviekfapikreieklkldk
dhlekvlqigsakakelaytvcqevkklvgfl

Sequence, based on observed residues (ATOM records): (download)

>d5ekdb_ c.26.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqkdskkrvfsgiqptgilhlgnylgaieswvrlqdeydsvlysivdlhsitvpqdpavl
rqsildmtavllacginpeksilfqqsqvsehtqlswilscmvrlprlqhlhqwkakttg
tvglltypvlqaadillyksthvpvgedqvqhmelvqdlaqgfnkkygeffpvpesilts
mkkvkslrdpsakmsksdpdklatvritdspeeivqkfrkavtdftsevtydpagragvs
nivavhaavtglsveevvrrsagmntaryklavadaviekfapikreieklkldkdhlek
vlqigsakakelaytvcqevkklvgfl

SCOPe Domain Coordinates for d5ekdb_:

Click to download the PDB-style file with coordinates for d5ekdb_.
(The format of our PDB-style files is described here.)

Timeline for d5ekdb_:

  • d5ekdb_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-17