Lineage for d5ekdb_ (5ekd B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (50 species)
    not a true protein
  7. 2106130Species Human (Homo sapiens) [TaxId:9606] [188230] (4 PDB entries)
  8. 2282977Domain d5ekdb_: 5ekd B: [326278]
    automated match to d2el7b_
    protein/RNA complex; complexed with 5bx, atp, gol, mn

Details for d5ekdb_

PDB Entry: 5ekd (more details), 1.82 Å

PDB Description: human mitochondrial tryptophanyl-trna synthetase bound by indolmycin and mn*atp.
PDB Compounds: (B:) Tryptophan--tRNA ligase, mitochondrial

SCOPe Domain Sequences for d5ekdb_:

Sequence, based on SEQRES records: (download)

>d5ekdb_ c.26.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqkdskkrvfsgiqptgilhlgnylgaieswvrlqdeydsvlysivdlhsitvpqdpavl
rqsildmtavllacginpeksilfqqsqvsehtqlswilscmvrlprlqhlhqwkakttk
qkhdgtvglltypvlqaadillyksthvpvgedqvqhmelvqdlaqgfnkkygeffpvpe
siltsmkkvkslrdpsakmsksdpdklatvritdspeeivqkfrkavtdftsevtydpag
ragvsnivavhaavtglsveevvrrsagmntaryklavadaviekfapikreieklkldk
dhlekvlqigsakakelaytvcqevkklvgfl

Sequence, based on observed residues (ATOM records): (download)

>d5ekdb_ c.26.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqkdskkrvfsgiqptgilhlgnylgaieswvrlqdeydsvlysivdlhsitvpqdpavl
rqsildmtavllacginpeksilfqqsqvsehtqlswilscmvrlprlqhlhqwkakttg
tvglltypvlqaadillyksthvpvgedqvqhmelvqdlaqgfnkkygeffpvpesilts
mkkvkslrdpsakmsksdpdklatvritdspeeivqkfrkavtdftsevtydpagragvs
nivavhaavtglsveevvrrsagmntaryklavadaviekfapikreieklkldkdhlek
vlqigsakakelaytvcqevkklvgfl

SCOPe Domain Coordinates for d5ekdb_:

Click to download the PDB-style file with coordinates for d5ekdb_.
(The format of our PDB-style files is described here.)

Timeline for d5ekdb_:

  • d5ekdb_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-17