SCOPe Funding Alert: SCOPe support from the NIH
ended in April 2016. John-Marc Chandonia is the primary
maintainer and has continued to develop SCOPe using vacation
time. Three proposals to the NIH for continued funding have been
unsuccessful. If our current NIH proposal is not funded,
SCOPe will shut down permanently in Summer 2017
as Dr. Chandonia will need to seek a new position.
Lineage for d5ekda_ (5ekd A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) 
Family c.26.1.0: automated matches [191377] (1 protein)
not a true familyProtein automated matches [190459] (46 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188230] (4 PDB entries) 
Domain d5ekda_: 5ekd A: [326333]
automated match to d2el7b_
protein/RNA complex; complexed with 5bx, atp, gol, mn
Details for d5ekda_
PDB Entry: 5ekd (more details), 1.82 Å
PDB Description: human mitochondrial tryptophanyl-trna synthetase bound by indolmycin and mn*atp.
PDB Compounds: (A:) Tryptophan--tRNA ligase, mitochondrialSCOPe Domain Sequences for d5ekda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ekda_ c.26.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkrvfsgiqptgilhlgnylgaieswvrlqdeydsvlysivdlhsitvpqdpavlrqsil
dmtavllacginpeksilfqqsqvsehtqlswilscmvrlprlqhlhqwkakttkqkhdg
tvglltypvlqaadillyksthvpvgedqvqhmelvqdlaqgfnkkygeffpvpesilts
mkkvkslrdpsakmsksdpdklatvritdspeeivqkfrkavtdftsevtydpagragvs
nivavhaavtglsveevvrrsagmntaryklavadaviekfapikreieklkldkdhlek
vlqigsakakelaytvcqevkklvgfl
SCOPe Domain Coordinates for d5ekda_:
Click to download the PDB-style file with coordinates for d5ekda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5ekda_:
- d5ekda_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-17
View in 3D
