SCOPe 2.07: Domain d5l67k_: 5l67 K:

Lineage for d5l67k_ (5l67 K:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [195917] (3 PDB entries)

8. Domain d5l67k_: 5l67 K: [325740]
   Other proteins in same PDB: d5l67a_, d5l67c_, d5l67d_, d5l67e_, d5l67g_, d5l67i_, d5l67j_, d5l67l_, d5l67o_, d5l67q_, d5l67r_, d5l67s_, d5l67u_, d5l67w_, d5l67x_, d5l67z_
   automated match to d5cgfk_
   complexed with 39v, cl, mes, mg

Details for d5l67k_

PDB Entry: 5l67, 2.6 Å

PDB Description: yeast 20s proteasome with mouse beta5i (1-138) and mouse beta6 (97- 111; 118-133) in complex with pr-924

PDB Compounds: (K:) Proteasome subunit beta type-8,Proteasome subunit beta type-5

SCOPe Domain Sequences for d5l67k_:

Sequence; same for both SEQRES and ATOM records:

>d5l67k_ d.153.1.4 (K:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tttlafkfqhgvivavdsratagsyisslrmnkvieinpyllgtmsgcaadcqywerlla
kecrlyylrngerisvsaaskllsnmmlqyrgmglsmgsmicgwdkkgpglyyvddngtr
lsgqmfstgsgntyaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhvt
edgwiyhgnhdvgelfwkvkeeegsfnnvig

Timeline for d5l67k_:

• d5l67k_ first appeared in SCOPe 2.06
  
• d5l67k_ appears in the current release, SCOPe 2.08