SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l67k_ (5l67 K:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2203920Protein automated matches [190144] (11 species)
    not a true protein
  7. 2204879Species Mouse (Mus musculus) [TaxId:10090] [195917] (3 PDB entries)
  8. 2282439Domain d5l67k_: 5l67 K: [325740]
    Other proteins in same PDB: d5l67a_, d5l67c_, d5l67d_, d5l67e_, d5l67g_, d5l67i_, d5l67j_, d5l67l_, d5l67o_, d5l67q_, d5l67r_, d5l67s_, d5l67u_, d5l67w_, d5l67x_, d5l67z_
    automated match to d5cgfk_
    complexed with 39v, cl, mes, mg

Details for d5l67k_

PDB Entry: 5l67 (more details), 2.6 Å

PDB Description: yeast 20s proteasome with mouse beta5i (1-138) and mouse beta6 (97- 111; 118-133) in complex with pr-924
PDB Compounds: (K:) Proteasome subunit beta type-8,Proteasome subunit beta type-5

SCOPe Domain Sequences for d5l67k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l67k_ d.153.1.4 (K:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tttlafkfqhgvivavdsratagsyisslrmnkvieinpyllgtmsgcaadcqywerlla
kecrlyylrngerisvsaaskllsnmmlqyrgmglsmgsmicgwdkkgpglyyvddngtr
lsgqmfstgsgntyaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhvt
edgwiyhgnhdvgelfwkvkeeegsfnnvig

SCOPe Domain Coordinates for d5l67k_:

Click to download the PDB-style file with coordinates for d5l67k_.
(The format of our PDB-style files is described here.)

Timeline for d5l67k_:

  • d5l67k_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-12