Lineage for d5l67u_ (5l67 U:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2602131Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2602132Protein automated matches [190509] (19 species)
    not a true protein
  7. 2602194Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2602347Domain d5l67u_: 5l67 U: [325915]
    Other proteins in same PDB: d5l67a_, d5l67b_, d5l67f_, d5l67h_, d5l67i_, d5l67j_, d5l67k_, d5l67l_, d5l67m_, d5l67n_, d5l67o_, d5l67p_, d5l67t_, d5l67v_, d5l67w_, d5l67x_, d5l67y_, d5l67z_
    automated match to d1irua_
    complexed with 39v, cl, mes, mg

Details for d5l67u_

PDB Entry: 5l67 (more details), 2.6 Å

PDB Description: yeast 20s proteasome with mouse beta5i (1-138) and mouse beta6 (97- 111; 118-133) in complex with pr-924
PDB Compounds: (U:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d5l67u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l67u_ d.153.1.0 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d5l67u_:

Click to download the PDB-style file with coordinates for d5l67u_.
(The format of our PDB-style files is described here.)

Timeline for d5l67u_: