Lineage for d5l5ub_ (5l5u B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2229253Domain d5l5ub_: 5l5u B: [325480]
    Other proteins in same PDB: d5l5ua_, d5l5uc_, d5l5ud_, d5l5ue_, d5l5ug_, d5l5ui_, d5l5uj_, d5l5uk_, d5l5ul_, d5l5un_, d5l5uo_, d5l5uq_, d5l5ur_, d5l5us_, d5l5uu_, d5l5uw_, d5l5ux_, d5l5uy_, d5l5uz_
    automated match to d1z7qc1
    complexed with 04c, cl, mg

Details for d5l5ub_

PDB Entry: 5l5u (more details), 2.6 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138; v31m) and human beta6 (97-111; 118-133) in complex with epoxyketone inhibitor 17
PDB Compounds: (B:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d5l5ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5ub_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d5l5ub_:

Click to download the PDB-style file with coordinates for d5l5ub_.
(The format of our PDB-style files is described here.)

Timeline for d5l5ub_: