Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
Domain d5l5ub_: 5l5u B: [325480] Other proteins in same PDB: d5l5ua_, d5l5uc_, d5l5ud_, d5l5ue_, d5l5ug_, d5l5ui_, d5l5uj_, d5l5uk_, d5l5ul_, d5l5un_, d5l5uo_, d5l5uq_, d5l5ur_, d5l5us_, d5l5uu_, d5l5uw_, d5l5ux_, d5l5uy_, d5l5uz_ automated match to d1z7qc1 complexed with 04c, cl, mg |
PDB Entry: 5l5u (more details), 2.6 Å
SCOPe Domain Sequences for d5l5ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l5ub_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d5l5ub_: