Lineage for d5l5uc_ (5l5u C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2230570Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2230571Protein automated matches [190509] (14 species)
    not a true protein
  7. 2230621Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2230758Domain d5l5uc_: 5l5u C: [325435]
    Other proteins in same PDB: d5l5ua_, d5l5ub_, d5l5uf_, d5l5ug_, d5l5uh_, d5l5ui_, d5l5uj_, d5l5uk_, d5l5ul_, d5l5um_, d5l5un_, d5l5uo_, d5l5up_, d5l5ut_, d5l5uu_, d5l5uv_, d5l5uw_, d5l5ux_, d5l5uy_, d5l5uz_
    automated match to d1iruf_
    complexed with 04c, cl, mg

Details for d5l5uc_

PDB Entry: 5l5u (more details), 2.6 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138; v31m) and human beta6 (97-111; 118-133) in complex with epoxyketone inhibitor 17
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5l5uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5uc_ d.153.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d5l5uc_:

Click to download the PDB-style file with coordinates for d5l5uc_.
(The format of our PDB-style files is described here.)

Timeline for d5l5uc_: