Lineage for d5l52r_ (5l52 R:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2224887Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2226213Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256264] (12 PDB entries)
  8. 2226239Domain d5l52r_: 5l52 R: [325245]
    Other proteins in same PDB: d5l52a_, d5l52e_, d5l52h_, d5l52i_, d5l52j_, d5l52k_, d5l52l_, d5l52m_, d5l52n_, d5l52o_, d5l52s_, d5l52v_, d5l52w_, d5l52x_, d5l52y_, d5l52z_
    automated match to d1iruf_
    complexed with 6n5, cl, mes, mg

Details for d5l52r_

PDB Entry: 5l52 (more details), 2.7 Å

PDB Description: yeast 20s proteasome in complex with epoxyketone inhibitor 14
PDB Compounds: (R:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d5l52r_:

Sequence, based on SEQRES records: (download)

>d5l52r_ d.153.1.4 (R:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records): (download)

>d5l52r_ d.153.1.4 (R:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

SCOPe Domain Coordinates for d5l52r_:

Click to download the PDB-style file with coordinates for d5l52r_.
(The format of our PDB-style files is described here.)

Timeline for d5l52r_: