Lineage for d5l52h_ (5l52 H:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2229536Domain d5l52h_: 5l52 H: [325138]
    Other proteins in same PDB: d5l52a_, d5l52b_, d5l52c_, d5l52d_, d5l52f_, d5l52g_, d5l52i_, d5l52j_, d5l52k_, d5l52l_, d5l52n_, d5l52o_, d5l52p_, d5l52q_, d5l52r_, d5l52t_, d5l52u_, d5l52w_, d5l52x_, d5l52y_, d5l52z_
    automated match to d4r17h_
    complexed with 6n5, cl, mes, mg

Details for d5l52h_

PDB Entry: 5l52 (more details), 2.7 Å

PDB Description: yeast 20s proteasome in complex with epoxyketone inhibitor 14
PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d5l52h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l52h_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

SCOPe Domain Coordinates for d5l52h_:

Click to download the PDB-style file with coordinates for d5l52h_.
(The format of our PDB-style files is described here.)

Timeline for d5l52h_: