Lineage for d5gm0b1 (5gm0 B:2-144)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051795Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2051796Protein automated matches [190437] (53 species)
    not a true protein
  7. 2052349Species Toxascaris leonina [TaxId:59264] [256287] (7 PDB entries)
  8. 2052352Domain d5gm0b1: 5gm0 B:2-144 [325052]
    Other proteins in same PDB: d5gm0a3, d5gm0b3
    automated match to d4hl0a1
    complexed with bgc, gal

Details for d5gm0b1

PDB Entry: 5gm0 (more details), 1.7 Å

PDB Description: tl-gal with lactose
PDB Compounds: (B:) galectin

SCOPe Domain Sequences for d5gm0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gm0b1 b.29.1.0 (B:2-144) automated matches {Toxascaris leonina [TaxId: 59264]}
atetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndvplhisvr
fdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevkeyehrvp
lssvthfsvdgdilityihwggk

SCOPe Domain Coordinates for d5gm0b1:

Click to download the PDB-style file with coordinates for d5gm0b1.
(The format of our PDB-style files is described here.)

Timeline for d5gm0b1: