Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (66 species) not a true protein |
Species Toxascaris leonina [TaxId:59264] [256287] (7 PDB entries) |
Domain d5gm0b1: 5gm0 B:2-144 [325052] Other proteins in same PDB: d5gm0a3, d5gm0b3 automated match to d4hl0a1 complexed with bgc, gal |
PDB Entry: 5gm0 (more details), 1.7 Å
SCOPe Domain Sequences for d5gm0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gm0b1 b.29.1.0 (B:2-144) automated matches {Toxascaris leonina [TaxId: 59264]} atetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndvplhisvr fdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevkeyehrvp lssvthfsvdgdilityihwggk
Timeline for d5gm0b1: