Lineage for d5ec7b_ (5ec7 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783393Species Chicken (Gallus gallus) [TaxId:9031] [225620] (18 PDB entries)
  8. 2783414Domain d5ec7b_: 5ec7 B: [324869]
    automated match to d5i11a_
    complexed with peg

Details for d5ec7b_

PDB Entry: 5ec7 (more details), 1.65 Å

PDB Description: crystal structure of a chimeric c-src-sh3 domain with the sequence of the rt-loop from the abl-sh3 domain at ph 5.0
PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d5ec7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ec7b_ b.34.2.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mtfvalydyvasgetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvaps

SCOPe Domain Coordinates for d5ec7b_:

Click to download the PDB-style file with coordinates for d5ec7b_.
(The format of our PDB-style files is described here.)

Timeline for d5ec7b_: