Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
Family d.185.1.1: MPP-like [63412] (7 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
Protein Cytochrome bc1 core subunit 1 [63408] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [55997] (18 PDB entries) Uniprot P31800 |
Domain d5klva1: 5klv A:1-233 [323986] Other proteins in same PDB: d5klvb1, d5klvb2, d5klvc1, d5klvc2, d5klvd1, d5klvd2, d5klve1, d5klve2, d5klvg_, d5klvh_, d5klvj_, d5klvk_ automated match to d1ntma1 complexed with 6pe, 8pe, cdl, cl, fes, fnm, gol, hec, hem, pef, px4 |
PDB Entry: 5klv (more details), 2.65 Å
SCOPe Domain Sequences for d5klva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5klva1 d.185.1.1 (A:1-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]} tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlsp
Timeline for d5klva1: