SCOPe 2.06: Domain d5klva2: 5klv A:234-446

Lineage for d5klva2 (5klv A:234-446)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (7 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 1 [63408] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [55997] (18 PDB entries)
   Uniprot P31800

8. Domain d5klva2: 5klv A:234-446 [323987]
   Other proteins in same PDB: d5klvb1, d5klvb2, d5klvc1, d5klvc2, d5klvd1, d5klvd2, d5klve1, d5klve2, d5klvg_, d5klvh_, d5klvj_, d5klvk_
   automated match to d1ntma2
   complexed with 6pe, 8pe, cdl, cl, fes, fnm, gol, hec, hem, pef, px4

Details for d5klva2

PDB Entry: 5klv, 2.65 Å

PDB Description: structure of bos taurus cytochrome bc1 with fenamidone inhibited

PDB Compounds: (A:) Cytochrome b-c1 complex subunit 1, mitochondrial

SCOPe Domain Sequences for d5klva2:

Sequence; same for both SEQRES and ATOM records:

>d5klva2 d.185.1.1 (A:234-446) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]}
crftgsqichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssp
lasiaatnklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatese
vlrgknllrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcsk
yfydqcpavagfgpieqlpdynrirsgmfwlrf

Timeline for d5klva2:

• d5klva2 is new in SCOPe 2.06-stable
  
• d5klva2 appears in SCOPe 2.07
  
• d5klva2 appears in the current release, SCOPe 2.08