Lineage for d5el9a1 (5el9 A:9-95)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930912Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2930913Protein automated matches [190826] (23 species)
    not a true protein
  7. 2931148Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [259809] (11 PDB entries)
  8. 2931149Domain d5el9a1: 5el9 A:9-95 [323600]
    Other proteins in same PDB: d5el9a2
    automated match to d4mu3a1
    complexed with 5dl, edo, mn, trs

Details for d5el9a1

PDB Entry: 5el9 (more details), 1.1 Å

PDB Description: a. thaliana igpd2 in complex with the triazole-phosphonate inhibitor, (s)-c348, to 1.1a resolution
PDB Compounds: (A:) Imidazoleglycerol-phosphate dehydratase 2, chloroplastic

SCOPe Domain Sequences for d5el9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5el9a1 d.14.1.0 (A:9-95) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdt
hiddhhtnedvalaigtallkalgerk

SCOPe Domain Coordinates for d5el9a1:

Click to download the PDB-style file with coordinates for d5el9a1.
(The format of our PDB-style files is described here.)

Timeline for d5el9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5el9a2