Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
Protein automated matches [190826] (23 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [259809] (11 PDB entries) |
Domain d5el9a1: 5el9 A:9-95 [323600] Other proteins in same PDB: d5el9a2 automated match to d4mu3a1 complexed with 5dl, edo, mn, trs |
PDB Entry: 5el9 (more details), 1.1 Å
SCOPe Domain Sequences for d5el9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5el9a1 d.14.1.0 (A:9-95) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} sarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdt hiddhhtnedvalaigtallkalgerk
Timeline for d5el9a1: