PDB entry 5el9

View 5el9 on RCSB PDB site
Description: A. thaliana IGPD2 in complex with the triazole-phosphonate inhibitor, (S)-C348, to 1.1A resolution
Class: lyase
Keywords: Herbicide discovery, Histidine biosynthesis, Inhibitor complex, Dehydratase, lyase
Deposited on 2015-11-04, released 2016-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: HISN5B, At4g14910, dl3495c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5el9a1, d5el9a2
  • Heterogens: MN, 5DL, TRS, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5el9A (A:)
    maspiesarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhv
    ratgdthiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrp
    ylgynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafara
    lrqatesdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5el9A (A:)
    sarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdt
    hiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynl
    eiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafaralrqate
    sdprrggtipsskgvlsrs