Lineage for d5arca_ (5arc A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873305Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2873306Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2873307Family c.41.1.1: Subtilases [52744] (15 proteins)
  6. 2873644Protein automated matches [190073] (16 species)
    not a true protein
  7. 2873676Species Bacillus lentus [TaxId:1467] [187257] (4 PDB entries)
  8. 2873677Domain d5arca_: 5arc A: [322834]
    automated match to d1c9ma_
    complexed with ca, ei3, gol, so4

Details for d5arca_

PDB Entry: 5arc (more details), 1.1 Å

PDB Description: cooperative bio-metallic selectivity in a tailored protease enables creation of a c-c cross-coupling heckase
PDB Compounds: (A:) Subtilisin Savinase

SCOPe Domain Sequences for d5arca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5arca_ c.41.1.1 (A:) automated matches {Bacillus lentus [TaxId: 1467]}
aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsvssiaqglewagnngmhva
nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyascngtsmatphvagaaalvkqknpswsnvqi
rnhlkntatslgstnlygsglvnaeaatr

SCOPe Domain Coordinates for d5arca_:

Click to download the PDB-style file with coordinates for d5arca_.
(The format of our PDB-style files is described here.)

Timeline for d5arca_: