Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.41: Subtilisin-like [52742] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3 |
Superfamily c.41.1: Subtilisin-like [52743] (3 families) |
Family c.41.1.1: Subtilases [52744] (15 proteins) |
Protein automated matches [190073] (16 species) not a true protein |
Species Bacillus lentus [TaxId:1467] [187257] (4 PDB entries) |
Domain d5arca_: 5arc A: [322834] automated match to d1c9ma_ complexed with ca, ei3, gol, so4 |
PDB Entry: 5arc (more details), 1.1 Å
SCOPe Domain Sequences for d5arca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5arca_ c.41.1.1 (A:) automated matches {Bacillus lentus [TaxId: 1467]} aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsvssiaqglewagnngmhva nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr asfsqygagldivapgvnvqstypgstyascngtsmatphvagaaalvkqknpswsnvqi rnhlkntatslgstnlygsglvnaeaatr
Timeline for d5arca_: