PDB entry 5arc

View 5arc on RCSB PDB site
Description: Cooperative bio-metallic selectivity in a tailored protease enables creation of a C-C cross-coupling Heckase
Class: hydrolase
Keywords: hydrolase, protease, subtilisin, catalysis, palladium, metalloenzyme, heck reaction, cross-coupling
Deposited on 2015-09-24, released 2016-09-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-05-06, with a file datestamp of 2020-05-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Subtilisin Savinase
  Species: Bacillus lentus [TaxId:1467]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29600 (0-268)
    • engineered mutation (210)
  Domains in SCOPe 2.08: d5arca_
• Heterogens: CA, EI3, SO4, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5arcA (A:)
  aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
  ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsvssiaqglewagnngmhva
  nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
  asfsqygagldivapgvnvqstypgstyascngtsmatphvagaaalvkqknpswsnvqi
  rnhlkntatslgstnlygsglvnaeaatr