Lineage for d5t64a_ (5t64 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146516Family c.66.1.60: C-3'-methyltransferase-like [310657] (2 proteins)
    Pfam PF08421; Pfam PF13489; Pfam PF08484 (in that order in the sequence)
  6. 2146529Protein automated matches [322740] (1 species)
    not a true protein
  7. 2146530Species Actinomadura kijaniata [TaxId:46161] [322741] (3 PDB entries)
  8. 2146533Domain d5t64a_: 5t64 A: [322791]
    automated match to d4e2xa_
    complexed with edo, mg, sah, tmp, zn

Details for d5t64a_

PDB Entry: 5t64 (more details), 1.7 Å

PDB Description: x-ray structure of the c3-methyltransferase kijd1 from actinomadura kijaniata in complex with tdp and sah
PDB Compounds: (A:) Sugar 3-C-methyl transferase

SCOPe Domain Sequences for d5t64a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t64a_ c.66.1.60 (A:) automated matches {Actinomadura kijaniata [TaxId: 46161]}
aparcrvcgdtvdefldlgrqplsdrfltpadtdgeffyrlavgrchacgmvqlteevpr
hlmfheeypyhssgssvmrehfakvaqrllateltgadpfvveigcndgimlravheagv
rhlgfepsagvaevarsrgvrvrteffekatatavresegpadviyaantmchipylesv
fqgadallgpdgvvvfedpylgdivaktsfdqiydehfylfsagsvaamaerfgfelvdv
erlpvhggevrytlarrgartpteavgrllaeereqglddlatlrtfaanvhtvrdelva
lltrlraeghrvvgygataksatvtnfcgigpdlvsfvcdttpgkqhrltpgkhlpvrpa
eafadpypdyallfawnhadeimakeqefrqaggrwilyvpevrvl

SCOPe Domain Coordinates for d5t64a_:

Click to download the PDB-style file with coordinates for d5t64a_.
(The format of our PDB-style files is described here.)

Timeline for d5t64a_: