Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) automatically mapped to Pfam PF02285 |
Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins) |
Protein Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81429] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
Species Cow (Bos taurus) [TaxId:9913] [81428] (33 PDB entries) |
Domain d5b1bz_: 5b1b Z: [322470] Other proteins in same PDB: d5b1ba_, d5b1bb1, d5b1bb2, d5b1bc_, d5b1bd_, d5b1be_, d5b1bf_, d5b1bg_, d5b1bh_, d5b1bi_, d5b1bj_, d5b1bk_, d5b1bl_, d5b1bn_, d5b1bo1, d5b1bo2, d5b1bp_, d5b1bq_, d5b1br_, d5b1bs_, d5b1bt_, d5b1bu_, d5b1bv_, d5b1bw_, d5b1bx_, d5b1by_ automated match to d1v54m_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5b1b (more details), 1.6 Å
SCOPe Domain Sequences for d5b1bz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b1bz_ f.23.7.1 (Z:) Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) {Cow (Bos taurus) [TaxId: 9913]} itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks
Timeline for d5b1bz_:
View in 3D Domains from other chains: (mouse over for more information) d5b1ba_, d5b1bb1, d5b1bb2, d5b1bc_, d5b1bd_, d5b1be_, d5b1bf_, d5b1bg_, d5b1bh_, d5b1bi_, d5b1bj_, d5b1bk_, d5b1bl_, d5b1bm_, d5b1bn_, d5b1bo1, d5b1bo2, d5b1bp_, d5b1bq_, d5b1br_, d5b1bs_, d5b1bt_, d5b1bu_, d5b1bv_, d5b1bw_, d5b1bx_, d5b1by_ |