![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) ![]() automatically mapped to Pfam PF05392 |
![]() | Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins) |
![]() | Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81420] (32 PDB entries) |
![]() | Domain d5b1bx_: 5b1b X: [322526] Other proteins in same PDB: d5b1ba_, d5b1bb1, d5b1bb2, d5b1bc_, d5b1bd_, d5b1be_, d5b1bf_, d5b1bg_, d5b1bh_, d5b1bi_, d5b1bj_, d5b1bl_, d5b1bm_, d5b1bn_, d5b1bo1, d5b1bo2, d5b1bp_, d5b1bq_, d5b1br_, d5b1bs_, d5b1bt_, d5b1bu_, d5b1bv_, d5b1bw_, d5b1by_, d5b1bz_ automated match to d1v54k_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5b1b (more details), 1.6 Å
SCOPe Domain Sequences for d5b1bx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b1bx_ f.23.5.1 (X:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus) [TaxId: 9913]} apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
Timeline for d5b1bx_:
![]() Domains from other chains: (mouse over for more information) d5b1ba_, d5b1bb1, d5b1bb2, d5b1bc_, d5b1bd_, d5b1be_, d5b1bf_, d5b1bg_, d5b1bh_, d5b1bi_, d5b1bj_, d5b1bk_, d5b1bl_, d5b1bm_, d5b1bn_, d5b1bo1, d5b1bo2, d5b1bp_, d5b1bq_, d5b1br_, d5b1bs_, d5b1bt_, d5b1bu_, d5b1bv_, d5b1bw_, d5b1by_, d5b1bz_ |