Lineage for d5f83b_ (5f83 B:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2245342Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2245343Protein automated matches [190857] (40 species)
    not a true protein
  7. 2245657Species Pseudomonas aeruginosa [TaxId:287] [189201] (28 PDB entries)
  8. 2245677Domain d5f83b_: 5f83 B: [322261]
    Other proteins in same PDB: d5f83a2
    automated match to d4h8ra_
    complexed with im2; mutant

Details for d5f83b_

PDB Entry: 5f83 (more details), 1.38 Å

PDB Description: imipenem complex of the ges-5 c69g mutant
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5f83b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f83b_ e.3.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ekltfktdleklerekaaqigvaivdpqgeivaghrmaqrfamgstfkfplaalvferid
sgtergdrklsygpdmivewspaterflasghmtvleaaqaavqlsdngatnlllreigg
paamtqyfrkigdsvsrldrkepemsdntpgdlrdtttpiamartvakvlyggaltstst
htierwlignqtgdatlragfpkdwvvgektgtcanggrndigffkaqerdyavavytta
pklsaverdelvasvgqvitqlilst

SCOPe Domain Coordinates for d5f83b_:

Click to download the PDB-style file with coordinates for d5f83b_.
(The format of our PDB-style files is described here.)

Timeline for d5f83b_: