Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [189201] (31 PDB entries) |
Domain d5f83b_: 5f83 B: [322261] Other proteins in same PDB: d5f83a2 automated match to d4h8ra_ complexed with im2; mutant |
PDB Entry: 5f83 (more details), 1.38 Å
SCOPe Domain Sequences for d5f83b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f83b_ e.3.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} ekltfktdleklerekaaqigvaivdpqgeivaghrmaqrfamgstfkfplaalvferid sgtergdrklsygpdmivewspaterflasghmtvleaaqaavqlsdngatnlllreigg paamtqyfrkigdsvsrldrkepemsdntpgdlrdtttpiamartvakvlyggaltstst htierwlignqtgdatlragfpkdwvvgektgtcanggrndigffkaqerdyavavytta pklsaverdelvasvgqvitqlilst
Timeline for d5f83b_: