Lineage for d1daea_ (1dae A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 988943Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 989038Protein Dethiobiotin synthetase [52653] (1 species)
  7. 989039Species Escherichia coli [TaxId:562] [52654] (13 PDB entries)
  8. 989046Domain d1daea_: 1dae A: [32205]
    complexed with ikt

Details for d1daea_

PDB Entry: 1dae (more details), 1.7 Å

PDB Description: dethiobiotin synthetase complexed with 3-(1-aminoethyl) nonanedioic acid
PDB Compounds: (A:) dethiobiotin synthetase

SCOPe Domain Sequences for d1daea_:

Sequence, based on SEQRES records: (download)

>d1daea_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]}
skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr
nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw
ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp
gkrhaeymttltrmipapllgeipwlaenpenaatgkyinlall

Sequence, based on observed residues (ATOM records): (download)

>d1daea_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]}
skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr
nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw
ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp
gkrhaeymttltrmipapllgeipwlaaatgkyinlall

SCOPe Domain Coordinates for d1daea_:

Click to download the PDB-style file with coordinates for d1daea_.
(The format of our PDB-style files is described here.)

Timeline for d1daea_: