SCOPe 2.08: Domain d1daea_: 1dae A:

Lineage for d1daea_ (1dae A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Dethiobiotin synthetase [52653] (1 species)

7. Species Escherichia coli [TaxId:562] [52654] (13 PDB entries)

8. Domain d1daea_: 1dae A: [32205]
   complexed with ikt

Details for d1daea_

PDB Entry: 1dae, 1.7 Å

PDB Description: dethiobiotin synthetase complexed with 3-(1-aminoethyl) nonanedioic acid

PDB Compounds: (A:) dethiobiotin synthetase

SCOPe Domain Sequences for d1daea_:

Sequence, based on SEQRES records:

>d1daea_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]}
skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr
nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw
ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp
gkrhaeymttltrmipapllgeipwlaenpenaatgkyinlall

Sequence, based on observed residues (ATOM records):

>d1daea_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]}
skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr
nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw
ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp
gkrhaeymttltrmipapllgeipwlaaatgkyinlall

Timeline for d1daea_:

• d1daea_ first appeared (with stable ids) in SCOP 1.55, called d1dae__
  
• d1daea_ appears in SCOPe 2.07