Lineage for d1g7ca3 (1g7c A:4-240)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179429Family c.37.1.8: G proteins [52592] (26 proteins)
  6. 179524Protein Elongation factor eEF-1alpha, N-terminal (G) domain [52631] (2 species)
  7. 179528Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52632] (4 PDB entries)
  8. 179530Domain d1g7ca3: 1g7c A:4-240 [32141]
    Other proteins in same PDB: d1g7ca1, d1g7ca2, d1g7cb_

Details for d1g7ca3

PDB Entry: 1g7c (more details), 2.05 Å

PDB Description: yeast eef1a:eef1ba in complex with gdpnp

SCOP Domain Sequences for d1g7ca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g7ca3 c.37.1.8 (A:4-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae)}
ekshinvvvighvdsgkstttghliykcggidkrtiekfekeaaelgkgsfkyawvldkl
kaerergitidialwkfetpkyqvtvidapghrdfiknmitgtsqadcailiiaggvgef
eagiskdgqtrehallaftlgvrqlivavnkmdsvkwdesrfqeivketsnfikkvgynp
ktvpfvpisgwngdnmieattnapwykgweketkagvvkgktlleaidaieqpsrpt

SCOP Domain Coordinates for d1g7ca3:

Click to download the PDB-style file with coordinates for d1g7ca3.
(The format of our PDB-style files is described here.)

Timeline for d1g7ca3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1g7cb_