Lineage for d1g7ca2 (1g7c A:335-443)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167761Fold b.44: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50464] (1 superfamily)
  4. 167762Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
  5. 167763Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (3 proteins)
  6. 167764Protein Elongation factor eEF-1alpha, C-terminal domain [50472] (2 species)
  7. 167768Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50473] (4 PDB entries)
  8. 167770Domain d1g7ca2: 1g7c A:335-443 [25746]
    Other proteins in same PDB: d1g7ca1, d1g7ca3, d1g7cb_

Details for d1g7ca2

PDB Entry: 1g7c (more details), 2.05 Å

PDB Description: yeast eef1a:eef1ba in complex with gdpnp

SCOP Domain Sequences for d1g7ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g7ca2 b.44.1.1 (A:335-443) Elongation factor eEF-1alpha, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
casfnatvivlnhpgqisagyspvldchtahiacrfdellekndrrsgkkledhpkflks
gdaalvkfvpskpmcveafseypplgrfavrdmrqtvavgviksvdkte

SCOP Domain Coordinates for d1g7ca2:

Click to download the PDB-style file with coordinates for d1g7ca2.
(The format of our PDB-style files is described here.)

Timeline for d1g7ca2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1g7cb_