SCOPe 2.06: Domain d5k81c_: 5k81 C:

Lineage for d5k81c_ (5k81 C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins)
   strand 5 is parallel to strand 4
   Pfam PF08210; Pfam PF05240

6. Protein automated matches [310855] (3 species)
   not a true protein

7. Species Macaca mulatta [TaxId:9544] [321104] (2 PDB entries)

8. Domain d5k81c_: 5k81 C: [321117]
   automated match to d3vm8a_
   complexed with zn

Details for d5k81c_

PDB Entry: 5k81, 2.01 Å

PDB Description: crystal structure of a primate apobec3g n-terminal domain

PDB Compounds: (C:) Apolipoprotein B mRNA editing enzyme, catalytic peptide-like 3G,Apolipoprotein B mRNA editing enzyme, catalytic peptide-like 3G

SCOPe Domain Sequences for d5k81c_:

Sequence; same for both SEQRES and ATOM records:

>d5k81c_ c.97.1.6 (C:) automated matches {Macaca mulatta [TaxId: 9544]}
mkpqirnmvepmdprtfvsnfnnrpilsgldtvwlccevktkdpsgppldakifqgkvyp
kakyhpemrflrwfhkwrqlhhdqeykvtwyvswspctrcansvatflakdpkvtltifv
arlyyfwkpdyqqalrilaeagatmkimnynefqdcwnkfvdgrgkpfkpwnnlpkhytl
lqatlgellrh

Timeline for d5k81c_:

• d5k81c_ is new in SCOPe 2.06-stable
  
• d5k81c_ appears in SCOPe 2.07
  
• d5k81c_ appears in the current release, SCOPe 2.08