Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
Domain d5jhsh_: 5jhs H: [320367] Other proteins in same PDB: d5jhsa_, d5jhsc_, d5jhsd_, d5jhse_, d5jhsg_, d5jhsi_, d5jhsj_, d5jhsk_, d5jhsl_, d5jhso_, d5jhsq_, d5jhsr_, d5jhss_, d5jhsu_, d5jhsw_, d5jhsx_, d5jhsy_, d5jhsz_ automated match to d4r17h_ complexed with 6kg, cl, mes, mg |
PDB Entry: 5jhs (more details), 3 Å
SCOPe Domain Sequences for d5jhsh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jhsh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d5jhsh_: