Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries) |
Domain d5jhsz_: 5jhs Z: [320455] Other proteins in same PDB: d5jhsa_, d5jhsb_, d5jhsf_, d5jhsh_, d5jhsi_, d5jhsj_, d5jhsk_, d5jhsm_, d5jhsn_, d5jhso_, d5jhsp_, d5jhst_, d5jhsv_, d5jhsw_, d5jhsx_, d5jhsy_ automated match to d1iru1_ complexed with 6kg, cl, mes, mg |
PDB Entry: 5jhs (more details), 3 Å
SCOPe Domain Sequences for d5jhsz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jhsz_ d.153.1.0 (Z:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd
Timeline for d5jhsz_: