Lineage for d5jhsz_ (5jhs Z:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2230570Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2230571Protein automated matches [190509] (14 species)
    not a true protein
  7. 2230621Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2230953Domain d5jhsz_: 5jhs Z: [320455]
    Other proteins in same PDB: d5jhsa_, d5jhsb_, d5jhsf_, d5jhsh_, d5jhsi_, d5jhsj_, d5jhsk_, d5jhsm_, d5jhsn_, d5jhso_, d5jhsp_, d5jhst_, d5jhsv_, d5jhsw_, d5jhsx_, d5jhsy_
    automated match to d1iru1_
    complexed with 6kg, cl, mes, mg

Details for d5jhsz_

PDB Entry: 5jhs (more details), 3 Å

PDB Description: yeast 20s proteasome in complex with the peptidic epoxyketone inhibitor 15
PDB Compounds: (Z:) Proteasome subunit beta type-6

SCOPe Domain Sequences for d5jhsz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jhsz_ d.153.1.0 (Z:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

SCOPe Domain Coordinates for d5jhsz_:

Click to download the PDB-style file with coordinates for d5jhsz_.
(The format of our PDB-style files is described here.)

Timeline for d5jhsz_: