Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.0: automated matches [238448] (1 protein) not a true family |
Protein automated matches [238450] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [238452] (4 PDB entries) |
Domain d5b32g_: 5b32 G: [320252] Other proteins in same PDB: d5b32a_, d5b32b_, d5b32c_, d5b32d_, d5b32e_, d5b32f_, d5b32h_ automated match to d1id3c_ protein/DNA complex; complexed with cl, mn |
PDB Entry: 5b32 (more details), 2.35 Å
SCOPe Domain Sequences for d5b32g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b32g_ a.22.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} avsrsqraglqfpvgrihrhlksrttshgrvgataavysaaileyltaevlelagnaskd lkvkritprhlqlairgdeeldslikatiagggviphihkslig
Timeline for d5b32g_: