Lineage for d1id3c_ (1id3 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987252Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1987253Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1987254Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1987255Protein Histone H2A [47115] (6 species)
  7. 1987327Species Baker's yeast (Saccharomyces cerevisiae), H2A.1 [TaxId:4932] [68984] (2 PDB entries)
  8. 1987328Domain d1id3c_: 1id3 C: [66114]
    Other proteins in same PDB: d1id3a_, d1id3b_, d1id3d_, d1id3e_, d1id3f_, d1id3h_
    protein/DNA complex; complexed with mn

Details for d1id3c_

PDB Entry: 1id3 (more details), 3.1 Å

PDB Description: crystal structure of the yeast nucleosome core particle reveals fundamental differences in inter-nucleosome interactions
PDB Compounds: (C:) histone h2a.1

SCOPe Domain Sequences for d1id3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1id3c_ a.22.1.1 (C:) Histone H2A {Baker's yeast (Saccharomyces cerevisiae), H2A.1 [TaxId: 4932]}
qsrsakagltfpvgrvhrllrrgnyaqrigsgapvyltavleylaaeilelagnaardnk
ktriiprhlqlairnddelnkllgnvtiaqggvlpnihqnllpkksakat

SCOPe Domain Coordinates for d1id3c_:

Click to download the PDB-style file with coordinates for d1id3c_.
(The format of our PDB-style files is described here.)

Timeline for d1id3c_: