SCOPe 2.06: Domain d4zolb2: 4zol B:246-440

Lineage for d4zolb2 (4zol B:246-440)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein Tubulin beta-subunit [55313] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [64322] (11 PDB entries)
   Uniprot P02554

8. Domain d4zolb2: 4zol B:246-440 [320196]
   Other proteins in same PDB: d4zola1, d4zola2, d4zolb1, d4zolc1, d4zolc2, d4zold1, d4zole_, d4zolf1, d4zolf2, d4zolf3
   automated match to d1sa0b2
   complexed with 55q, acp, ca, gdp, gol, gtp, mes, mg

Details for d4zolb2

PDB Entry: 4zol, 2.5 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-tubulysin m complex

PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d4zolb2:

Sequence; same for both SEQRES and ATOM records:

>d4zolb2 d.79.2.1 (B:246-440) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdata

Timeline for d4zolb2:

• d4zolb2 is new in SCOPe 2.06-stable
  
• d4zolb2 appears in SCOPe 2.07
  
• d4zolb2 appears in the current release, SCOPe 2.08