Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein Tubulin beta-subunit [55313] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [64322] (11 PDB entries) Uniprot P02554 |
Domain d4zolb2: 4zol B:246-440 [320196] Other proteins in same PDB: d4zola1, d4zola2, d4zolb1, d4zolc1, d4zolc2, d4zold1, d4zole_, d4zolf1, d4zolf2, d4zolf3 automated match to d1sa0b2 complexed with 55q, acp, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 4zol (more details), 2.5 Å
SCOPe Domain Sequences for d4zolb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zolb2 d.79.2.1 (B:246-440) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqdata
Timeline for d4zolb2: