SCOPe 2.06: Domain d4zolc2: 4zol C:246-440

Lineage for d4zolc2 (4zol C:246-440)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (5 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278816] (9 PDB entries)

8. Domain d4zolc2: 4zol C:246-440 [320185]
   Other proteins in same PDB: d4zola1, d4zolb1, d4zolb2, d4zolc1, d4zold1, d4zold2, d4zole_, d4zolf1, d4zolf2, d4zolf3
   automated match to d4i50a2
   complexed with 55q, acp, ca, gdp, gol, gtp, mes, mg

Details for d4zolc2

PDB Entry: 4zol, 2.5 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-tubulysin m complex

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d4zolc2:

Sequence; same for both SEQRES and ATOM records:

>d4zolc2 d.79.2.1 (C:246-440) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

Timeline for d4zolc2:

• d4zolc2 is new in SCOPe 2.06-stable
  
• d4zolc2 appears in SCOPe 2.07
  
• d4zolc2 appears in the current release, SCOPe 2.08