SCOPe 2.06: Domain d5efhd_: 5efh D:

Lineage for d5efhd_ (5efh D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families)

5. Family c.42.1.0: automated matches [191435] (1 protein)
   not a true family

6. Protein automated matches [190626] (8 species)
   not a true protein

7. Species Danio rerio [TaxId:7955] [319911] (19 PDB entries)

8. Domain d5efhd_: 5efh D: [319993]
   automated match to d3c10c_
   complexed with br, edo, fks, gol, k, zn

Details for d5efhd_

PDB Entry: 5efh, 2.16 Å

PDB Description: crystal structure of danio rerio histone deacetylase 6 catalytic domain 2 in complex with trifluoroketone transition state analogue

PDB Compounds: (D:) Hdac6 protein

SCOPe Domain Sequences for d5efhd_:

Sequence; same for both SEQRES and ATOM records:

>d5efhd_ c.42.1.0 (D:) automated matches {Danio rerio [TaxId: 7955]}
itglvydqrmmlhhnmwdshhpelpqrisrifsrheelrllsrchriparlateeelalc
hsskhisiikssehmkprdlnrlgdeynsifisnesytcallaagscfnsaqailtgqvr
navaivrppghhaekdtacgfcffntaaltaryaqsitreslrvlivdwdvhhgngtqhi
feeddsvlyislhryedgaffpnsedanydkvglgkgrgynvnipwnggkmgdpeymaaf
hhlvmpiarefapelvlvsagfdaargdplggfqvtpegyahlthqlmslaagrvliile
ggynltsisesmsmctsmllgdsppsldhltplktsatvsinnvlrahapfwsslr

Timeline for d5efhd_:

• d5efhd_ is new in SCOPe 2.06-stable
  
• d5efhd_ appears in SCOPe 2.07
  
• d5efhd_ appears in the current release, SCOPe 2.08