SCOPe 2.03: Domain d1qhna_: 1qhn A:

Lineage for d1qhna_ (1qhn A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.3: Chloramphenicol phosphotransferase [52569] (1 protein)
   similar to the nucleotide/nucleoside kinases but acts on different substrate
   automatically mapped to Pfam PF07931

6. Protein Chloramphenicol phosphotransferase [52570] (1 species)

7. Species Streptomyces venezuelae [TaxId:54571] [52571] (6 PDB entries)

8. Domain d1qhna_: 1qhn A: [31937]
   complexed with so4

Details for d1qhna_

PDB Entry: 1qhn, 2.7 Å

PDB Description: chloramphenicol phosphotransferase from streptomyces venezuelae

PDB Compounds: (A:) chloramphenicol phosphotransferase

SCOPe Domain Sequences for d1qhna_:

Sequence; same for both SEQRES and ATOM records:

>d1qhna_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}
mttrmiilnggssagksgivrclqsvlpepwlafgvdslieamplkmqsaeggiefdadg
gvsigpefralegawaegvvamaragariiiddvflggaaaqerwrsfvgdldvlwvgvr
cdgavaegretargdrvagmaakqayvvhegveydvevdtthkesiecawaiaahvvp

Timeline for d1qhna_:

• d1qhna_ first appeared (with stable ids) in SCOP 1.55
  
• d1qhna_ appears in SCOPe 2.02
  
• d1qhna_ appears in SCOPe 2.04
  
• d1qhna_ appears in the current release, SCOPe 2.08