PDB entry 1qhn

View 1qhn on RCSB PDB site
Description: chloramphenicol phosphotransferase from streptomyces venezuelae
Class: transferase
Keywords: kinase, antibiotic resistance, phosphorylation, mononucleotide binding fold, transferase
Deposited on 1999-05-23, released 2000-06-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.201
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloramphenicol phosphotransferase
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56148 (0-177)
      • modified residue (0)
      • modified residue (4)
      • modified residue (42)
      • modified residue (46)
      • modified residue (81)
      • modified residue (139)
    Domains in SCOPe 2.03: d1qhna_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qhnA (A:)
mttrmiilnggssagksgivrclqsvlpepwlafgvdslieamplkmqsaeggiefdadg
gvsigpefralegawaegvvamaragariiiddvflggaaaqerwrsfvgdldvlwvgvr
cdgavaegretargdrvagmaakqayvvhegveydvevdtthkesiecawaiaahvvp