Lineage for d1qhna_ (1qhn A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.3: Chloramphenicol phosphotransferase [52569] (1 protein) Protein Chloramphenicol phosphotransferase [52570] (1 species) Species Streptomyces venezuelae [TaxId:54571] [52571] (4 PDB entries) 
Domain d1qhna_: 1qhn A: [31937]
Details for d1qhna_
PDB Entry: 1qhn (more details), 2.7 Å
PDB Description: chloramphenicol phosphotransferase from streptomyces venezuelae
SCOP Domain Sequences for d1qhna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qhna_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae}
mttrmiilnggssagksgivrclqsvlpepwlafgvdslieamplkmqsaeggiefdadg
gvsigpefralegawaegvvamaragariiiddvflggaaaqerwrsfvgdldvlwvgvr
cdgavaegretargdrvagmaakqayvvhegveydvevdtthkesiecawaiaahvvp
SCOP Domain Coordinates for d1qhna_:
Click to download the PDB-style file with coordinates for d1qhna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qhna_:
- d1qhna_ appears in SCOP 1.57
- d1qhna_ appears in the current release, SCOPe 2.08
View in 3D