SCOPe 2.08: Domain d5h9sa_: 5h9s A:

Lineage for d5h9sa_ (5h9s A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (109 PDB entries)

8. Domain d5h9sa_: 5h9s A: [319049]
   automated match to d4xzpa_
   complexed with tgz

Details for d5h9sa_

PDB Entry: 5h9s, 1.82 Å

PDB Description: crystal structure of human galectin-7 in complex with taztdg

PDB Compounds: (A:) galectin-7

SCOPe Domain Sequences for d5h9sa_:

Sequence; same for both SEQRES and ATOM records:

>d5h9sa_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
snvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevv
fnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrl
vevggdvqldsvrif

Timeline for d5h9sa_:

• d5h9sa_ first appeared in SCOPe 2.06
  
• d5h9sa_ appears in SCOPe 2.07