Class a: All alpha proteins [46456] (289 folds) |
Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) |
Family a.40.1.0: automated matches [227151] (1 protein) not a true family |
Protein automated matches [226856] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224978] (30 PDB entries) |
Domain d5a38a2: 5a38 A:149-257 [318683] automated match to d1tjta2 mutant |
PDB Entry: 5a38 (more details), 1.9 Å
SCOPe Domain Sequences for d5a38a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a38a2 a.40.1.0 (A:149-257) automated matches {Human (Homo sapiens) [TaxId: 9606]} eetsakeglllwcqrktapyrnvniqnfhtswkdglglcalihrhrpdlidysklnkddp igninlameiaekhldipkmldaedivntpkpderaimtyvscfyhafa
Timeline for d5a38a2: