Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) both pyridine (Pyr)- and pyrophosphate (PP)-binding modules have this fold conserved core consists of two Pyr and two PP-modules and binds two coenzyme molecules |
Family c.36.1.1: Pyruvate oxidase and decarboxylase THDP-binding domains [52519] (4 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
Protein Pyruvate decarboxylase [52520] (3 species) |
Species Zymomonas mobilis [TaxId:542] [52523] (1 PDB entry) |
Domain d1zpdf3: 1zpd F:363-566 [31792] Other proteins in same PDB: d1zpda1, d1zpdb1, d1zpde1, d1zpdf1 complexed with cit, dpx, mg |
PDB Entry: 1zpd (more details), 1.86 Å
SCOP Domain Sequences for d1zpdf3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zpdf3 c.36.1.1 (F:363-566) Pyruvate decarboxylase {Zymomonas mobilis} aplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpaa fgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgpyn niknwdyaglmevfngnggydsgaakglkaktggelaeaikvalantdgptliecfigre dcteelvkwgkrvaaansrkpvnk
Timeline for d1zpdf3: