SCOPe 2.08: Domain d5j8yc1: 5j8y C:1137-1204

Lineage for d5j8yc1 (5j8y C:1137-1204)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (3 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [186750] (3 PDB entries)

8. Domain d5j8yc1: 5j8y C:1137-1204 [317539]
   Other proteins in same PDB: d5j8ya2, d5j8yb2, d5j8yc2, d5j8yd2
   automated match to d4pzna_

Details for d5j8yc1

PDB Entry: 5j8y, 1.98 Å

PDB Description: crystal structure of the scm-sam and sfmbt-sam heterodimer

PDB Compounds: (C:) Polycomb protein Sfmbt

SCOPe Domain Sequences for d5j8yc1:

Sequence; same for both SEQRES and ATOM records:

>d5j8yc1 a.60.1.0 (C:1137-1204) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pdtwnvydvsqflrvndctahcdtfsrnkidgkrllqltkddimpllgmkvgpalkisdl
iaqlkckv

Timeline for d5j8yc1:

• d5j8yc1 first appeared in SCOPe 2.06
  
• d5j8yc1 appears in SCOPe 2.07