Lineage for d4zqyc_ (4zqy C:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032490Family g.7.1.0: automated matches [191613] (1 protein)
    not a true family
  6. 3032491Protein automated matches [191119] (7 species)
    not a true protein
  7. 3032495Species Hemachatus haemachatus [TaxId:8626] [317319] (1 PDB entry)
  8. 3032498Domain d4zqyc_: 4zqy C: [317320]
    automated match to d2h8ua_

Details for d4zqyc_

PDB Entry: 4zqy (more details), 2.95 Å

PDB Description: ringhalexin from hemachatus haemachatus: a novel inhibitor of extrinsic tenase complex
PDB Compounds: (C:) Ringhalexin

SCOPe Domain Sequences for d4zqyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zqyc_ g.7.1.0 (C:) automated matches {Hemachatus haemachatus [TaxId: 8626]}
rlclsdysifsetieicpeghnycfkkfpkgitrlpwvirgcaatcpkpeaqvyvdccar
dkcnr

SCOPe Domain Coordinates for d4zqyc_:

Click to download the PDB-style file with coordinates for d4zqyc_.
(The format of our PDB-style files is described here.)

Timeline for d4zqyc_: