Class g: Small proteins [56992] (100 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) |
Family g.7.1.0: automated matches [191613] (1 protein) not a true family |
Protein automated matches [191119] (7 species) not a true protein |
Species Hemachatus haemachatus [TaxId:8626] [317319] (1 PDB entry) |
Domain d4zqya_: 4zqy A: [317331] automated match to d2h8ua_ |
PDB Entry: 4zqy (more details), 2.95 Å
SCOPe Domain Sequences for d4zqya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zqya_ g.7.1.0 (A:) automated matches {Hemachatus haemachatus [TaxId: 8626]} rlclsdysifsetieicpeghnycfkkfpkgitrlpwvirgcaatcpkpeaqvyvdccar dkcnr
Timeline for d4zqya_: