Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (20 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries) |
Domain d5b1xc1: 5b1x C:106-233 [317208] Other proteins in same PDB: d5b1xa2, d5b1xb2, d5b1xc2, d5b1xd2 automated match to d1b6ea_ complexed with ca, man, nag |
PDB Entry: 5b1x (more details), 2.9 Å
SCOPe Domain Sequences for d5b1xc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b1xc1 d.169.1.0 (C:106-233) automated matches {Human (Homo sapiens) [TaxId: 9606]} cpknwksfssncyfistesaswqdsekdcarmeahllvintqeeqdfifqnlqeesayfv glsdpegqrhwqwvdqtpynesstfwhprepsdpnercvvlnfrkspkrwgwndvnclgp qrsvcemm
Timeline for d5b1xc1: