Lineage for d5b1xa1 (5b1x A:106-234)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608201Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2608202Protein automated matches [190159] (20 species)
    not a true protein
  7. 2608257Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries)
  8. 2608553Domain d5b1xa1: 5b1x A:106-234 [317192]
    Other proteins in same PDB: d5b1xa2, d5b1xb2, d5b1xc2, d5b1xd2
    automated match to d1b6ea_
    complexed with ca, man, nag

Details for d5b1xa1

PDB Entry: 5b1x (more details), 2.9 Å

PDB Description: crystal structure of human dendritic cell inhibitory receptor (dcir) c-type lectin domain in complex with biantennary glycan
PDB Compounds: (A:) C-type lectin domain family 4 member A

SCOPe Domain Sequences for d5b1xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1xa1 d.169.1.0 (A:106-234) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cpknwksfssncyfistesaswqdsekdcarmeahllvintqeeqdfifqnlqeesayfv
glsdpegqrhwqwvdqtpynesstfwhprepsdpnercvvlnfrkspkrwgwndvnclgp
qrsvcemmk

SCOPe Domain Coordinates for d5b1xa1:

Click to download the PDB-style file with coordinates for d5b1xa1.
(The format of our PDB-style files is described here.)

Timeline for d5b1xa1: