Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
Protein automated matches [190266] (7 species) not a true protein |
Species Human immunodeficiency virus 1, escherichia coli [TaxId:11676] [189090] (3 PDB entries) |
Domain d5dzmb_: 5dzm B: [317200] automated match to d3k2pa_ |
PDB Entry: 5dzm (more details), 2.05 Å
SCOPe Domain Sequences for d5dzmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dzmb_ c.55.3.1 (B:) automated matches {Human immunodeficiency virus 1, escherichia coli [TaxId: 11676]} lyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiyla lqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpa
Timeline for d5dzmb_: